PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009768032.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 95aa    MW: 10874.9 Da    PI: 10.7112
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009768032.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF565.2e-1838731449
                    HHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF 14 skRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    skRr g++KKA+EL++LC++e+a+i++s+  k++ +
  XP_009768032.1 38 SKRRSGLFKKASELCTLCGVEIAIIVYSPARKVFSF 73
                    9*****************************999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-93276IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.2783577IPR002100Transcription factor, MADS-box
PfamPF003191.5E-183873IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.06E-193890IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-103954IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-105475IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MIVFRLQLKN KITYSISNIG RYLLFSLTII YLNIILISKR RSGLFKKASE LCTLCGVEIA  60
IIVYSPARKV FSFGHPNVES IVDRFLSRNH NPISN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2402045e-45AC240204.1 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-33m2 map 1, complete sequence.
GenBankHG9755135e-45HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009768032.11e-62PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK21e-26AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLK4B2N82e-28K4B2N8_SOLLC; Uncharacterized protein
TrEMBLM1DTB51e-28M1DTB5_SOLTU; Uncharacterized protein
STRINGSolyc01g106710.1.16e-28(Solanum lycopersicum)
STRINGPGSC0003DMT4000940624e-28(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20424223
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.17e-28AGAMOUS-like 62